Decoding

Eloralintide_Dosage, benefits & legal status

Also searched as EloraTZP, Elora TZP, eloralintide + tirzepatide, Elora, ELO, LY3841136

Eloralintide is in phase 3 as a single agent for obesity. Its phase 2b combination with tirzepatide is covered in the EloraTZP trial report.

By the Peptide Decoding Editorial Team

Published July 22, 2026 · Updated October 4, 2026

An experimental weekly fullness-hormone shot for weight loss.

Weight lossAmylin agonistInvestigational

InAmylin analogsWeight loss

37 amino acidsFrom published structure

Sequence

▸ See the chain

ECNTATCATGKLAEFLVRSSNNFGPKLPPTEVGSNTY

The fatty chain hangs from position 26, in the middle of the chain, where cagrilintide and lenbelintide carry theirs on the first residue. Three residues, at 11, 15 and 22, are not found in nature.

Position 1 · gamma-glutamyl · substitution
Joined through its side chain, shown here as E.
Position 2-7 · methylene thioacetal · bridge
The two cysteines are joined through one extra carbon, in place of the direct link natural amylin has.
Position 11 · ornithine · substitution
Shown as K, its closest standard relative.
Position 15 · alpha-methyl-phenylalanine · substitution
Shown as F.
Position 22 · N-methyl-asparagine · substitution
Shown as N.
Position 26 · K · acylation
A 20-carbon fatty diacid on a short spacer of two gamma-glutamic acids.
Position C-terminus · amidation

Common vial size10 mg

Dose1 up to 9 mg per week (trial doses)

FrequencyWeekly

RouteUnder the skin (subcutaneous)

StatusInvestigational

MixYour choice, open the Eloralintide calculator

CycledNot cycled in the trials

Common vial size is what vendors typically sell, not a recommendation. Enter your own vial in the calculator.

See how this dose compares across the library →

What is Eloralintide?

Plain language first. The technical label stays, but it never stands alone.

Overview

It copies the pancreas's fullness hormone for weight loss, designed to be easy to tolerate. It is still in trials.

The technical version

Eloralintide is an amylin receptor agonist from Eli Lilly.

What it's used for

An experimental weekly shot that copies a natural fullness hormone for weight loss, positioned as easy to tolerate.

How does Eloralintide work?

What it does in the body, and where.

Eloralintide is an amylin receptor agonist designed with tolerability as the main goal.

01
It signals fullness through amylin receptors
A separate route from the GLP-1 drugs.
02
Built to be easier to tolerate
The gut side effects that make people stop taking GLP-1 drugs are the problem this is trying to design around.
03
Investigational
Phase 2 published in 2025. Not approved.

Anatomical illustration highlighting metabolic organs

WHAT THIS COMPOUND ACTS ON:

amylinFullness from the pancreas

What else is it used for?

Each use below carries its own evidence level. Approved means regulators have cleared it for that purpose. Investigational means it is in trials. Early research means it is being studied and is not established.

Weight loss, designed to be easier on the stomach than the GLP-1 drugsInvestigational

The published record

Research index

Papers and trials about Eloralintide

Searched: Eloralintide, LY3841136.

31 papers tagged human · 3 not reviews or lab · 3 clinical trial publications

24 registered trials · 1 with posted results

Furthest stage reached: Phase 3, under way

Compare this against the whole library →

Browse the records

In animals4

In the lab0

Reviews6

Senior author shareSpread across many groups

Evidence summary

Counted from Europe PMC indexing, not read by a person; a human tag can land on reviews, commentary or lab papers; clinical trial publications is the narrower count.

Compound field notes

At a glance

Four things to know about Eloralintide

Evidence

Investigational

How much, and do you cycle it?

The range, and whether you take breaks.

1 up to 9 mg per week (trial doses), weekly. Not cycled in the trials Trial dose

Given continuously for the whole study period: 48 weeks in phase 2, 75 to 80 weeks in phase 3. The dose is stepped up at the start, which is a ramp rather than a cycle, and no trial in this class built in a planned break.

Compare this against the whole library →

How long does it stay in the body?

The half-life, and where the figure comes from.

14 to 16 daysTrial protocol

Source: Briere, et al. Mol Metab 2025, PMID 41109426. ADA 2025 abstract 882-P

You can compare this against the whole library to see where it sits.

How do I dose and price it?

Enter your vial and your dose. Pick a mix. We show the draw and the cost.

The vial holds a fixed amount of drug. Adding more water does not make more drug, it just spreads it thinner, so you draw a bigger number on the syringe for the same dose.

Your vial size (mg)

Printed on the vial.

What you paid per vial

Used for cost per dose only.

Your dose (mg)

Commonly referenced range: 1 up to 9 mgTrial dose

Choose your mix

Easiest0.5 mL water5units · 20 mg/mL

Half a 100-unit syringe

Easiest1 mL water10units · 10 mg/mL

One full 100-unit syringe

Easiest2 mL water20units · 5 mg/mL

Two full 100-unit syringes

Easiestyour own mL

units · —

Enter your own volume

Measuring the water1 mL = one full 100-unit syringe.

YOUR DRAW20 / 100 units

Full calculator with reorder date →Read a syringe →

What it costs

Eloralintide starts at $59.00 across 24 vendors, typically $9.73 – $43.50 per mg.

29 listings, last read Oct 24, 2026. Shipping and card fees are not included.

See all 29 listings →

How do you store it?

Before mixing, and after.

Dry powder in the freezer or fridge. Once mixed, fridge, and use within about a month.

Unmixed lyophilized Eloralintide keeps for a long time cold. Once you add water the clock starts: most reconstituted vials hold up for roughly 28 to 30 days at fridge temperature. Keep it out of light, and do not freeze it after mixing.

What are the side effects and cautions?

Known cautions and warnings for this compound.

Solubility, computed: 22% charged residues, 41% hydrophobic. Water usually sufficient.

A first-pass rule from peptide manufacturers' guidance. It does not account for disulfide bridges, salt form or how the powder was dried, and it predicts what should be easy rather than what will happen in your vial.

Who should avoid it

Check these before anything else.

No formal contraindications established
Pregnancy

Stop and get help

These are emergencies. Seek care.

Vomiting badly enough that you cannot keep fluids down
Signs of an allergic reaction such as face or throat swelling, hives, or trouble breathing

Common effects

Expected, and usually mild.

Notably easier on the stomach than the GLP-1 drugs
Reduced appetite in about a fifth of people, headache in about one in eight
Nausea in about a third at higher doses, against 14% on placebo

Where this page says nothing is established, that means nobody has studied it, not that a compound is safe.

Is Eloralintide approved?

And where the numbers on this page come from.

No. Eloralintide is not approved anywhere and is currently in company-run clinical trials. There is no legal route to obtain it outside a trial.

Approval status
Investigational
Route
Under the skin (subcutaneous)
Checked
14 August 2026
Dose
From published clinical trials. Not approved by a regulator for this dose.
Vial size
From what vendors typically list; not a recommendation.
Sources
None traced yet.

What has happened recently

We have not yet written a full regulatory note for this compound. The status above is current as of the date shown.

You can compare this against the whole library, or read how to check a seller.

What else is like Eloralintide?

Others in Amylin analogs, side by side.

If you're weighing Eloralintide, it's worth reading CagriSema, Retatrutide + Cagrilintide blend, and Petrelintide in the same class.

YOU ARE HERE

Eloralintide

An experimental weekly fullness-hormone shot for weight loss.

Investigational

Dose: 1 up to 9 mg per week (trial doses)
How often: Weekly

CAGSEM

CagriSema

A weekly two-in-one shot combining cagrilintide and semaglutide for bigger loss.

Investigational

Dose: 2.4 mg cagrilintide plus 2.4 mg semaglutide per week
How often: Weekly

RETA-CAG

Retatrutide + Cagrilintide blend

An unapproved triple agonist paired with an amylin analog, tested by nobody.

Research only

Dose: Research only
How often: Weekly, by convention

PETRE

Petrelintide

An experimental weekly fullness-hormone shot for weight loss.

Investigational

Dose: 1.0 up to 9.0 mg per week (trial maintenance doses, not an approved dose)
How often: Weekly

How Eloralintide stacks up against other amylins

Guides for this compound

How to Reconstitute a Peptide
Mix peptide powder with bacteriostatic water, step by step.
How to Read an Insulin Syringe
Read the units, convert to millilitres, and draw the exact dose.
mcg vs mg: The Peptide Dosing Mistake to Avoid
Your vial says mg and your protocol says mcg. Here is the conversion and how to check it.
The full guide to eloralintide
What the phase 2 trial showed, the doses it used, the side effects and what is still unknown.
How to Read a Peptide COA
What the purity number does and does not tell you, and how to spot an edited report.

Sources

No primary source has been traced for this compound yet. Treat everything on this page as unverified until one is. How we grade evidence

Beyond these, 34 records are indexed. Browse the records